General Information

  • ID:  hor005539
  • Uniprot ID:  P61855
  • Protein name:  Adipokinetic hormone
  • Gene name:  Akh
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  AKH/HRTH/RPCH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0097005 adipokinetic hormone receptor binding
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0009743 response to carbohydrate; GO:0010898 positive regulation of triglyceride catabolic process; GO:0032024 positive regulation of insulin secretion; GO:0033500 carbohydrate homeostasis; GO:0042593 glucose homeostasis; GO:0042594 response to starvation; GO:0045819 positive regulation of glycogen catabolic process; GO:0055088 lipid homeostasis
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QLTFSPDW
  • Length:  8(23-30)
  • Propeptide:  MNPKSEVLIAAVLFMLLACVQCQLTFSPDWGKRSVGGAGPGTFFETQQGNCKTSNEMLLEIFRFVQSQAQLFLDCKHRE
  • Signal peptide:  MNPKSEVLIAAVLFMLLACVQC
  • Modification:  T1 Pyrrolidone carboxylic acid;T8 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Probably causes a marked increase in hemolymph carbohydrate.
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  AkhR
  • Target Unid:  Q7KTL9
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P61855-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005539_AF2.pdbhor005539_ESM.pdb

Physical Information

Mass: 111812 Formula: C47H64N10O14
Absent amino acids: ACEGHIKMNRVY Common amino acids: DFLPQSTW
pI: 3.75 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -55 Boman Index: -1000
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: 6967.5 Extinction Coefficient cystines: 5500
Absorbance 280nm: 785.71

Literature

  • PubMed ID:  2117437
  • Title:  The fruitfly Drosophila melanogaster contains a novel charged adipokinetic-hormone-family peptide.
  • PubMed ID:  12171930
  • Title:   Peptidomics of the larval Drosophila melanogaster central nervous system.